PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00044.1_g00052.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family M-type_MADS
Protein Properties Length: 218aa    MW: 24741.7 Da    PI: 9.0982
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00044.1_g00052.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.51.5e-171050242
                             ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                   SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                              ien+  r+ tf kR+ gi+KKA ELS+LCd+ vav + s+
  Rsa1.0_00044.1_g00052.1 10 YIENDNSRKATFRKRKGGIMKKALELSTLCDVPVAVFVQSE 50
                             59**********************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.6E-20160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.217161IPR002100Transcription factor, MADS-box
CDDcd002662.19E-21286No hitNo description
PRINTSPR004044.8E-12323IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.24E-22396IPR002100Transcription factor, MADS-box
PfamPF003191.2E-161150IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-122338IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-123859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MARNRVRMAY IENDNSRKAT FRKRKGGIMK KALELSTLCD VPVAVFVQSE YKPVPEVFPA  60
SREAMGNVLA KWDMLSLVDK TKRMVNQEKF LQQRIDKATE GIKKVDKENK ELAMKEVMFD  120
CLSEKTAPCF LVKDDLPELA GVIDHYIKRL NRRMQILTMN DASSSSSVIP PAVATAVAMP  180
RAEMGFYSTG FNGMIQENMN VMTNVKDFDL NQAQDEYP
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00044.1_g00052.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018479318.11e-160PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A0D3DCK84e-99A0A0D3DCK8_BRAOL; Uncharacterized protein
TrEMBLA0A3P6EH824e-99A0A3P6EH82_BRAOL; Uncharacterized protein
STRINGBo7g095090.11e-100(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26630.15e-54M-type_MADS family protein