PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00044.1_g00049.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family M-type_MADS
Protein Properties Length: 364aa    MW: 42013.3 Da    PI: 5.7745
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00044.1_g00049.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.81.6e-141152344
                             --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
                   SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                             i +k+ r +tf kR++g +KK +EL +LC+++++ +++s ++
  Rsa1.0_00044.1_g00049.1 11 IPDKTSRRTTFKKRKAGFMKKLNELVTLCGVKACAVVYSDQN 52
                             7899***********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.694161IPR002100Transcription factor, MADS-box
SMARTSM004325.5E-16161IPR002100Transcription factor, MADS-box
CDDcd002665.46E-28384No hitNo description
PRINTSPR004045.0E-8323IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-20396IPR002100Transcription factor, MADS-box
PfamPF003192.6E-151152IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MVRSRVKLSL IPDKTSRRTT FKKRKAGFMK KLNELVTLCG VKACAVVYSD QNDANPEAWP  60
SRAEAGEVIS KFMEFPEVER DKKMYDQKRY TLERISKEQA TLQRLQEENR EFELKEIMFN  120
LIKGKRMMQH HSNDASFLYD LTKFIDFNVS ELTKRIHLLQ ANGEPISFLP LDDGDVDAAH  180
PAVGDVNPIA GADVAAVRMP YGFNFDHIQN MNMNVNQQAP AYHIPYQNMN QQELFRNQVP  240
TNFSGHVQYP NMMNYPEQFQ YQVPNNVYDH NKHGFYGLNQ GMGLDLDPNL SESFNQYPNL  300
HDQPCMNQWM AQPQQTSYAE DLATLASMDD DYNNYHQLPS TSYMPPMDLP ALNTNNLPTR  360
FGLD
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00044.1_g00049.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018482569.10.0PREDICTED: agamous-like MADS-box protein AGL86
TrEMBLM4D0B30.0M4D0B3_BRARP; Uncharacterized protein
STRINGBra009911.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26650.16e-48AGAMOUS-like 36