PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00033.1_g00042.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 647aa    MW: 70929.5 Da    PI: 5.8058
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00033.1_g00042.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.63.8e-16360398240
                      TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                              ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  Rsa1.0_00033.1_g00042.1 360 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 398
                              689**********************************96 PP

2TCR52.69e-17445483139
                      TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                              ++k+gCnCkks+ClkkYCeCf+ g+ Cs +C+Ce+CkN 
  Rsa1.0_00033.1_g00042.1 445 RHKRGCNCKKSNCLKKYCECFQGGVGCSINCRCEGCKNA 483
                              589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.4E-19359400IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.245360485IPR005172CRC domain
PfamPF036386.1E-12362397IPR005172CRC domain
SMARTSM011142.1E-17445486IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.8E-12447483IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 647 aa     Download sequence    Send to blast
MQDSPVFNYI NSLSPIRPVK SIPNPHQFST LNFTSPPSVF TSPHLTSSHK ESRFFKTHHP  60
SSDPTTIPLQ ESPDDSASNV EAVAEADATT EFNIDASTEM EQPQIVKETN LDDPLAVSPC  120
GSRETTDLSL VPYASPPREE NNGEDAAGME MQKMMNDNVQ GKNETPDWDR LIADSSEFLI  180
FSSPNDSEAF RCLMMQRASP SQAPSVMPTM QPGSINEPES SNASPYGAVS VLHRGIRRRC  240
LDFEMPGNKQ TSSENNTVAC GSSSRCVVPS IGLHLNALLM STKDCKTNTT THDYSCSEKY  300
QVGLQGSSST LQETLDQTET ATRDLEVVPD EPTLEELHLS SPKKKRQVLV KMEAGEGESS  360
CKRCNCKKSK CLKLYCECFA AGVYCIEPCS CIDCFNKPIH EDTVLATRKQ IESRNPLAFA  420
PKVIKSSDLV LETGDDASKT PASARHKRGC NCKKSNCLKK YCECFQGGVG CSINCRCEGC  480
KNAFGRKDGS SIVDMEAEQE EENETSKKTK RTKNQENTEV YLMRKEESSA LAATPMSIYR  540
QQLVQLKNMM PPPQSVLGGG SSSSGMFNSQ YTRKPEMKSL ETVAEDGAEE MPEILSHTSI  600
DNTKAVSPNG KRVSPPHLDS SSSGRRSGGR KLILQSIPTF PSLTPQH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1636448214120Protein lin-54 homolog
5fd3_B1e-1636448214120Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00033.1_g00042.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018470228.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLA0A3P6EYZ40.0A0A3P6EYZ4_BRAOL; Uncharacterized protein
STRINGBo1g057470.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.10.0TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]