PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00027.1_g00042.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 732aa    MW: 80550.9 Da    PI: 7.535
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00027.1_g00042.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY78.57.6e-25146202259
                              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              +Dgy+WrKYGqK+vk+ + +rsYYrCt+++C++kk +e+s++ ++v+ei+++g+H he
  Rsa1.0_00027.1_g00042.1 146 RDGYHWRKYGQKQVKSPKGSRSYYRCTYSDCCAKK-IECSNDSGNVIEIVNKGSHSHE 202
                              7********************************98.*********************8 PP

2WRKY96.12.4e-30309365359
                              -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              Dgy+WrKYGqK+vkg+++pr+YYrCtsagC+v+k++e++ ++ ++v+itY+g Hnh+
  Rsa1.0_00027.1_g00042.1 309 DGYRWRKYGQKMVKGNPNPRNYYRCTSAGCTVRKHIETAVDNRTAVVITYKGVHNHD 365
                              9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.7E-19142203IPR003657WRKY domain
SuperFamilySSF1182905.23E-19143202IPR003657WRKY domain
SMARTSM007741.3E-22145203IPR003657WRKY domain
PfamPF031061.0E-16147201IPR003657WRKY domain
PROSITE profilePS5081115.078147204IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.8E-31292367IPR003657WRKY domain
PROSITE profilePS5081131.881302367IPR003657WRKY domain
SuperFamilySSF1182903.01E-26303367IPR003657WRKY domain
SMARTSM007748.9E-34307366IPR003657WRKY domain
PfamPF031061.4E-22309365IPR003657WRKY domain
HamapMF_0136320.53606704IPR001787Ribosomal protein L21
SuperFamilySSF1410913.14E-27607702IPR028909Ribosomal protein L21-like
TIGRFAMsTIGR000615.2E-23607703IPR001787Ribosomal protein L21
PfamPF008291.4E-28607702IPR028909Ribosomal protein L21-like
PROSITE patternPS011690673695IPR018258Ribosomal protein L21, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006412Biological Processtranslation
GO:0005840Cellular Componentribosome
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0003735Molecular Functionstructural constituent of ribosome
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 732 aa     Download sequence    Send to blast
MEDKGSDEAD VYAATETEKT EKVEPEKELC HGDDDDDELS RRRGEESVTD MEGIQVRETL  60
AKDHDEGARE NSPVEPNRED AKEKASGTES DVGAIVPVET STCLSSNPSA AHGVSLVSVL  120
SKQEQSSGSR VVSNLSVSPV LRTPARDGYH WRKYGQKQVK SPKGSRSYYR CTYSDCCAKK  180
IECSNDSGNV IEIVNKGSHS HEPLRNNSFS PRETRAAAPV ISPVTEDSTG VRSCSALSAS  240
TKENICESSL AVVEGKRNCE NEAMEEPEPK RRQVLLKKSN SQSSDPVFKP GKKQRFVVHA  300
AGDVGISGDG YRWRKYGQKM VKGNPNPRNY YRCTSAGCTV RKHIETAVDN RTAVVITYKG  360
VHNHDMPVPK KRHGPPSSEL VAAVAPTSMR TRSEDQVNIP TSGQCSVRGG SEKQSSEAVD  420
VVGGEKVMES ARTLLSIGRS AEAFNRVDSP NPTTSKTPLT SLGKTLSYTR CSPMASLRCL  480
RELSRRATTA AHSINQTRLF SSFHRLELPG TSSITHGIPS QNRSLARDLP LYCRSQGRHF  540
SSKTNDTDES SDGDDDEEDY EDSGEMEVVE REYSPAEKVE AAAEIGYKVM GPLKPLERLF  600
KPYEPVFAVV QIGSHQFKVS NGDSIFTEKL KFCDINDKVL LLGSASQTII GRPILPDATV  660
HAVVEEHALD EKVLIFKKKR RKNYRRTTGH RQELTKLRIT DIQGIEKPEP KIIHKPSKAA  720
ADTEQSEAKL VA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-24298367877Probable WRKY transcription factor 4
2lex_A2e-24298367877Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1676680KKKRR
2676681KKKRRK
3677681KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300490.0KF430049.1 Brassica rapa WRKY transcription factor 32 (WRKY32) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002867320.10.0hypothetical protein ARALYDRAFT_328625
SwissprotP595830.0WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLD7MBK50.0D7MBK5_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_70008520.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.10.0WRKY DNA-binding protein 32