PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00019.1_g00036.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 295aa    MW: 33680.5 Da    PI: 9.1415
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00019.1_g00036.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.93.6e-32214272159
                              ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              ldDgy+WrKYGqK+vk++++prsYYrCt+ +C+vkk+ver a+dpk+v++tYeg+H h 
  Rsa1.0_00019.1_g00036.1 214 LDDGYRWRKYGQKVVKNTQHPRSYYRCTQDKCRVKKRVERLADDPKMVITTYEGRHLHA 272
                              59******************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.0E-33199272IPR003657WRKY domain
SuperFamilySSF1182904.45E-28207272IPR003657WRKY domain
PROSITE profilePS5081129.241209274IPR003657WRKY domain
SMARTSM007741.0E-36214273IPR003657WRKY domain
PfamPF031063.6E-25215271IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901141Biological Processregulation of lignin biosynthetic process
GO:1904369Biological Processpositive regulation of sclerenchyma cell differentiation
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGTINQGISL YDEPQRIINP SRNHLGFFLS FPNQTLSSSP TSSPSLVSPF IGHHSLNSFL  60
QHNPPSCLTH PQDPINSMAN LPETLISISS LSASKQKDAH DTIVNLDHHR LNCGTSSRSS  120
LNQWAGSFQA EYGYSKKNNH GSEIHVYDID DDVGNGGRIN VDEDHQHNDT LRRHKHNTTP  180
VGVGCTLKMK KLKTRRKVRE PRFCFKTLSD VDVLDDGYRW RKYGQKVVKN TQHPRSYYRC  240
TQDKCRVKKR VERLADDPKM VITTYEGRHL HAPSNHLDDD SLSYSHHSHL SNFFW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-26205271874Probable WRKY transcription factor 4
2lex_A2e-26205271874Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00019.1_g00036.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018447703.10.0PREDICTED: probable WRKY transcription factor 13
SwissprotQ9SVB71e-131WRK13_ARATH; Probable WRKY transcription factor 13
TrEMBLA0A078HZ290.0A0A078HZ29_BRANA; BnaA01g05500D protein
TrEMBLA0A398AKA20.0A0A398AKA2_BRACM; Uncharacterized protein
TrEMBLM4D5V40.0M4D5V4_BRARP; Uncharacterized protein
STRINGBra011861.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61062746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39410.11e-111WRKY DNA-binding protein 13