PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00016.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 290aa    MW: 31430.7 Da    PI: 6.6519
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00016.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA94.41.3e-29186241158
                CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                              +ep+YVNaKQy++Il+RR++Rak+e e+k+   +rkpylheSRhkhA+rR+R+sgGrF
  Rsa1.0_00016.1_g00003.1 186 QEPVYVNAKQYEGILRRRKARAKAELERKV--INRKPYLHESRHKHAMRRARASGGRF 241
                              69***************************9..89***********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.4E-31184244IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.587185244IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.5E-26187241IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.2E-23188210IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860190210IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.2E-23218241IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MQPKSGRGNE AEVNDHHPAD QQQQPMMYPE PWWKNNAAFG VIPPPSSGLP SNSSSLDCPN  60
GSESNDLHSA SEDGAAGAND AAWKDSSQAV TSSPSGLVFF PLLGFITVDH HGMEGSDPTH  120
VAASMHNQQP VQPPELVGHY MACVPNPYQD PYYAGMMGAY GHQPLGFRPY LGMPRERTAL  180
PLDITQEPVY VNAKQYEGIL RRRKARAKAE LERKVINRKP YLHESRHKHA MRRARASGGR  240
FAKKTEAEAA EDAAAAAAGR EREKGSATNS SGSEPVETDS NETFNSSGAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-15185241158NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1225234RHKHAMRRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013667993.11e-160PREDICTED: nuclear transcription factor Y subunit A-1-like
RefseqXP_013667994.11e-160PREDICTED: nuclear transcription factor Y subunit A-1-like
SwissprotQ9LXV51e-151NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA0A078E7K91e-160A0A078E7K9_BRANA; BnaC09g44190D protein
STRINGBra008878.1-P1e-151(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59462646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.31e-115nuclear factor Y, subunit A1