PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00015.1_g00022.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 466aa    MW: 51557.1 Da    PI: 5.4333
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00015.1_g00022.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.16.6e-07150212163
                              XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              e+e +r rr   NRe+Ar   +R++a +eeL +k++ L  eN+ L+ e +   ke ++l++ +
  Rsa1.0_00015.1_g00022.1 150 EREERRIRRILANRESARQTIRRRQAMCEELSKKAADLAYENENLRREKDWALKEFESLETIN 212
                              78899******************************************9999889988888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.7E-8150214IPR004827Basic-leucine zipper domain
PfamPF001704.9E-7150212IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.013152215IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.47E-6154209No hitNo description
Gene3DG3DSA:1.20.5.1705.6E-6154220No hitNo description
CDDcd147022.17E-12160205No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MELEPTSSCC STSSSEEDAE AAAANMTELE AAEALADLAQ LAVMREQVFE SAASWGSKGK  60
RVRKRVKTES PPPPDSETLP TPDLPEERAV KEEEEDVVVE PISREVTEVP VKTESNGGET  120
PPKPNLASTL RCNNRPSGCG RSRQNLSEAE REERRIRRIL ANRESARQTI RRRQAMCEEL  180
SKKAADLAYE NENLRREKDW ALKEFESLET INKHLKEQVA KSVQPETKES PKPSQVEMST  240
SSTTPFYFYN QNPYQLFCWP HVTHPSNPMV SPHESQNGFT APFTTTGGVS AKAMTSQENG  300
NPGDDNGQKT HFYVVPCPWF LPAPPPDQSN GVPFAFEDQQ RVVSSNGHHH IDDSSPKPVE  360
VTKTLTSIKE EDSGSTETTR PLYDLNESAA EALSEGDGAP ATTQQGFSFK HEDVSDSANG  420
VTPGHRVLMS LQGKKQGSLA AAEARKRRKE LTKLKNLHGR QCRMQV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1444449RKRRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00015.1_g00022.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893560.0AC189356.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB043O20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018438214.10.0PREDICTED: uncharacterized protein LOC108810603 isoform X1
TrEMBLA0A078HLP80.0A0A078HLP8_BRANA; BnaC05g15020D protein
STRINGBo5g027510.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM112112428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.11e-162bZIP family protein