PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00011.1_g00027.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 525aa    MW: 56504.5 Da    PI: 8.35
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00011.1_g00027.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.31.7e-14107146141
                      TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                              ++kk+CnCk+s+Clk+YCeCfa g++C+  C+C +C+N+ +
  Rsa1.0_00011.1_g00027.1 107 QKKKHCNCKHSRCLKLYCECFATGTYCDG-CNCVNCFNNVD 146
                              589**************************.********976 PP

2TCR51.32.3e-16187225139
                      TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                              k++kgCnCkks ClkkYCeCf+a+  Cse+CkC dCkN 
  Rsa1.0_00011.1_g00027.1 187 KHNKGCNCKKSGCLKKYCECFQANILCSENCKCLDCKNF 225
                              589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.1E-16107147IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.143108227IPR005172CRC domain
PfamPF036387.6E-11109144IPR005172CRC domain
SMARTSM011147.5E-19187228IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.9E-13190225IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MGNAAGRGEF PPKNDGGSGE SARMPARQLH FTGGSDQQHS LSKPAPTTAA KPVDTPSLPS  60
PVTVTTPTTT MTSRLHPVVR QTSNPPKQES PISRPRPIVE GRDGTPQKKK HCNCKHSRCL  120
KLYCECFATG TYCDGCNCVN CFNNVDKETA RRDAVEAILE RNPNAFRPKI ASSPRGVRDK  180
KEEMLGKHNK GCNCKKSGCL KKYCECFQAN ILCSENCKCL DCKNFDGSEE RLALFHGEHA  240
NNMAYLQQAA NAAITGAVGS SGFAPSPASK RRKGGQDISF NQATKDTSSP AAPSKFVYRS  300
LLADVIQPQD VKALCSVLVA VAGEAAKTLT DKRNANRVED QTETSLASAA QENSQGDVEM  360
AEADKSGQEG SNSDASKGKP LSPATLALMC DDEQDTIFMV AASEPNGSVD PGGCRTNSQW  420
QSQNYAEQER AVLTKLRDCL SRLISYAELK ESKCLYLARR HIQSPPTATT TVKTENGVQQ  480
VPPIVNGATT QPTVNKPQLL QAMTATNTSS THHPHKPPAL PEKDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A7e-3210923611132Protein lin-54 homolog
5fd3_B7e-3210923611132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00011.1_g00027.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596271.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
RefseqXP_013705473.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A3P6F4W30.0A0A3P6F4W3_BRAOL; Uncharacterized protein
STRINGBo7g113450.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein