PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00009.1_g00056.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 334aa    MW: 35942.7 Da    PI: 9.7576
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00009.1_g00056.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1231e-3879137361
                   zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                              e alkcprCds ntkfCyynny+l+qPryfCkaCrryWt+GGalrnvPvGgg+rkn k+
  Rsa1.0_00009.1_g00056.1  79 EGALKCPRCDSINTKFCYYNNYNLTQPRYFCKACRRYWTRGGALRNVPVGGGCRKNSKK 137
                              5689****************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3064132IPR003851Zinc finger, Dof-type
PfamPF027015.9E-3381136IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.31182136IPR003851Zinc finger, Dof-type
PROSITE patternPS01361084120IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009625Biological Processresponse to insect
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MVFSSNWSQP TNPNNHQHQL HENGSLVSDH GLLSHQLPPC PPNPNPNHHY AAATASGLPA  60
RLGGSMAERA RQAKAPPPEG ALKCPRCDSI NTKFCYYNNY NLTQPRYFCK ACRRYWTRGG  120
ALRNVPVGGG CRKNSKKGKN SNSKSSSSLS KQSSSTVNAP SSNSGQLRTN HQFPFLPTMH  180
NLTQLGGIGL NLAATSGNNQ GHQIGSSLMN DLGFLHVGNG RNIHDNNNNG SINNLMASAG  240
SLSHFSLFDP TTGLHAFQNE GNILNNVGIS FSSTSMVDSR AYQAAPVKME EQPGLVNLSR  300
PVSGLTSPGN QTNQYLWNSS DFSGPSSNDH HQLL
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). Involved in the regulation of root development (PubMed:23057675). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Element of a regulatory network controlling indole glucosinolates (IGS) biosynthesis, probably by inducing the expression of accurate genes (e.g. CYP83B1). Promotes apical dominance (PubMed:16740150). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:16740150, ECO:0000269|PubMed:23057675, ECO:0000269|PubMed:30626969}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00009.1_g00056.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA) (PubMed:10758484). Induced transiently in response to the generalist herbivore S.littoralis. Triggered by methyl jasmonate (MeJA) and wounding (PubMed:16740150). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:16740150}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5842850.0FJ584285.1 Brassica rapa subsp. pekinensis OBF binding protein 2 Dof1.1-2 gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018450572.10.0PREDICTED: dof zinc finger protein DOF1.1-like
SwissprotQ8L9V61e-155DOF11_ARATH; Dof zinc finger protein DOF1.1
TrEMBLA0A3N6QQG30.0A0A3N6QQG3_BRACR; Uncharacterized protein
STRINGBra030696.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.31e-143Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]