PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00009.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 199aa    MW: 22610.2 Da    PI: 10.0931
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00009.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.81e-3421112192
                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 
                              aCa+Ck++r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k++++++ee+r+++ +sl++eA +r++dPv G++g +++++++
  Rsa1.0_00009.1_g00005.1  21 ACASCKHQRKKCNNECILSPYFPARKTKEFQAVHKVFGVSNVQKMVRTVREEDRTKLSESLTWEALWRQKDPVLGSYGEYRRVSEE 106
                              7***********************************************************************************99 PP

                   DUF260  87 leqlka 92 
                              l+  k+
  Rsa1.0_00009.1_g00005.1 107 LKLYKS 112
                              998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.00920120IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-3221112IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MMQRNSTNNN ISNNTSSSHQ ACASCKHQRK KCNNECILSP YFPARKTKEF QAVHKVFGVS  60
NVQKMVRTVR EEDRTKLSES LTWEALWRQK DPVLGSYGEY RRVSEELKLY KSLVHNQPLI  120
GWDNNQRVLN NNNKNGLAVN SSGSGGFSVN NNGVGGNREV INGGYTSRSL HGGYENLRQD  180
QRQQCYAVIN GFKQHYLPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-181298288LOB family transfactor Ramosa2.1
5ly0_B1e-181298288LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00009.1_g00005.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018449852.11e-146PREDICTED: LOB domain-containing protein 2
SwissprotQ9LNB91e-115LBD2_ARATH; LOB domain-containing protein 2
TrEMBLA0A078K3Y51e-124A0A078K3Y5_BRANA; BnaCnng78580D protein
TrEMBLA0A0D3DJ501e-124A0A0D3DJ50_BRAOL; Uncharacterized protein
STRINGBo8g006050.11e-124(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.12e-89LOB domain-containing protein 2