PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC9887_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GATA
Protein Properties Length: 239aa    MW: 26447.8 Da    PI: 8.6487
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC9887_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA51.71.2e-16741135
        GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  RrC9887_p2  7 CYHCGVTSTPLWRNGPPEKPVLCNACGSRWRTKGS 41
                ****************88888***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.6E-9155IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.7E-12546No hitNo description
CDDcd002021.30E-15663No hitNo description
PfamPF003202.1E-14741IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.6E-13741IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MGKQGPCYHC GVTSTPLWRN GPPEKPVLCN ACGSRWRTKG SLVNYTPLHA RAEGDEVEIE  60
DRRGQKKMMM MINGMSVNRK IPKRKPYQEN FTVKEFSNGF KKRALEEEAS NNRSSSGSVV  120
SNSESCDQSN AWEACKKRTC VGPRPKAASS VEKLTKDLFS ILQEQQSSCL SGTSEEELLF  180
ENESPMVIGH GSVLMRDLHS GPRDEESEAS SLLVGSSKCS SVHSQNFGGK AIKQEQLKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013612537.11e-127PREDICTED: GATA transcription factor 27-like isoform X3
SwissprotQ5PP381e-120GAT27_ARATH; GATA transcription factor 27
TrEMBLA0A0D3AUX01e-126A0A0D3AUX0_BRAOL; Uncharacterized protein
TrEMBLM4E0101e-127M4E010_BRARP; Uncharacterized protein
STRINGBra022107.1-P1e-126(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16062785
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47140.11e-116GATA transcription factor 27