PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC9438_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YC
Protein Properties Length: 187aa    MW: 21215.8 Da    PI: 7.5104
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC9438_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC45.12.2e-14851691599
       NF-YC  15 dfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                 + k  ++P++ri++i+++d+   +i  +a  l+ ka elfi  ++  ++  + + k++ ++   ++++v++   ++fl+d vp++
  RrC9438_p2  85 EAKMIRFPMTRIRRIMRSDNSAPQIMQDAVFLVNKATELFIERFSEEAYGSSVKDKKKFIHYKHLSSVVSNEGRYEFLTDCVPEK 169
                 567789****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008081.5E-2090153IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.105.8E-2391168IPR009072Histone-fold
SuperFamilySSF471131.04E-17100168IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MVSSKKPKSD VVVVDKGNGL NNTRSSGSKA KNKKKTPNKA DLKDYVARKE TEEEVRDEIS  60
ESSSSSEEAR RDDEPKESNG VVSEEAKMIR FPMTRIRRIM RSDNSAPQIM QDAVFLVNKA  120
TELFIERFSE EAYGSSVKDK KKFIHYKHLS SVVSNEGRYE FLTDCVPEKL KAEVALEEWE  180
RSMADVG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7971473e-42KC797147.1 Brassica napus transcription factor subunit NF-YC10B (NF-YC10B) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009148047.17e-87PREDICTED: chromatin accessibility complex protein 1
RefseqXP_013646475.17e-87PREDICTED: chromatin accessibility complex protein 1-like
TrEMBLM4DQ758e-87M4DQ75_BRARP; Uncharacterized protein
STRINGBra018668.1-P2e-86(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.12e-62nuclear factor Y, subunit C10