PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC9409_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 286aa    MW: 30615.8 Da    PI: 8.9984
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC9409_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.8e-3946105362
      zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 ++ +kcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk s
  RrC9409_p1  46 DHPQKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKPS 105
                 6789*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-343499IPR003851Zinc finger, Dof-type
PfamPF027017.9E-3347103IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.76149103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MLDSTTTSPS AADILAACST QPQASAVAVA AAAMMDGGRR LRPPHDHPQK CPRCESTHTK  60
FCYYNNYSLS QPRYFCKTCR RYWTKGGTLR NIPVGGGCRK NKKPSSSNTS SSKKPSSDLM  120
ALAHSHQNYQ NASLGFSHFG GNGMMGSYTA PNHSNVGFLE SKYGGLFSQS PRPIDFLDGK  180
FDLMGVNNNL VMVDHGSNGD HQHNHHMGLS HGLGLNNNNN NDNQRVTSVM DVKPSPKLLS  240
LDWQQEQGYS EGSGNGGGGR SDGSGYGGGG GYINSLGSSW NSLMNG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0090531e-129AB009053.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MQB2.
GenBankAK2289921e-129AK228992.1 Arabidopsis thaliana mRNA for Dof zinc finger protein - like, complete cds, clone: RAFL16-29-O12.
GenBankBT0204671e-129BT020467.1 Arabidopsis thaliana At5g62940 gene, complete cds.
GenBankBT0205761e-129BT020576.1 Arabidopsis thaliana At5g62940 gene, complete cds.
GenBankCP0026881e-129CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018452806.11e-154PREDICTED: dof zinc finger protein DOF5.6-like
TrEMBLA0A0D3E1Y01e-135A0A0D3E1Y0_BRAOL; Uncharacterized protein
TrEMBLM4F4731e-135M4F473_BRARP; Uncharacterized protein
STRINGBra035873.1-P1e-136(Brassica rapa)
STRINGBo9g016320.11e-136(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63742746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.11e-101Dof family protein