PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC9299_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family M-type_MADS
Protein Properties Length: 322aa    MW: 36251 Da    PI: 10.0985
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC9299_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF47.42.5e-151050242
                ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
      SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                +i n+s r+ t+ kR+ g+lKK +E+S+LC++++  ii+s+
  RrC9299_p1 10 FIVNNSLRKATYKKRKRGLLKKVHEISTLCGINAGAIIYSP 50
                799************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.6E-21160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.245149IPR002100Transcription factor, MADS-box
CDDcd002663.26E-15285No hitNo description
PRINTSPR004041.2E-7323IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-22395IPR002100Transcription factor, MADS-box
PfamPF003192.2E-131151IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MARKKVKLAF IVNNSLRKAT YKKRKRGLLK KVHEISTLCG INAGAIIYSP YDPTPEVWPS  60
VEGMNQVIAA FRNLPEIDRH NNMVNQREFI QQRITKADKL MRKQKKDNRE VKLTEDMYRF  120
LQMGQLTIPA GGHNDPSLVR DLNDLGYLVD QYRNSLNRRI QILEGGSDVE IGESSNVVAA  180
TAPATTVHGL GSSSSSAAAG ASLFNQMSLF PQNQQQFHQP YAPYALRFYE QARNQSQSLE  240
MMNMGYAANQ MGFPFMGNAH HYHQTHHHQP QQPRWFRGES STAPQQLQLF PGESSAVPPP  300
ATSGSVPPDA TTQNPTNNIW FR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVKLAFIVNNSLRKATYKKRK
21524LRKATYKKRK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6084924e-61AB608492.1 Raphanus sativus DNA, microsatellite locus RsSH024, cultivar: rat-tail radish.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018455838.10.0PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK33e-65AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A3P5ZG071e-117A0A3P5ZG07_BRACM; Uncharacterized protein
STRINGBra041022.1-P1e-114(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-56AGAMOUS-like 80
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]