PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC9163_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 604aa    MW: 67182.6 Da    PI: 7.9581
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC9163_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR30.86e-103493741540
         TCR  15 kkYCeCfaagkkCseeCkCedCkNke 40 
                  +YCeCfaag++C e C+C dC+Nk 
  RrC9163_p2 349 ENYCECFAAGVYCIEPCSCVDCFNKP 374
                 68**********************96 PP

2TCR46.47.7e-15421459139
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                 ++k+ CnCkks+ClkkYCeCf++g+ Cs +C+ e+CkN 
  RrC9163_p2 421 RHKRVCNCKKSNCLKKYCECFQSGVGCSINCRYEGCKNA 459
                 58999*********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163429.735341461IPR005172CRC domain
PfamPF036381.6E-6349373IPR005172CRC domain
SMARTSM011142.6E-4350376IPR033467Tesmin/TSO1-like CXC domain
SMARTSM011145.2E-13421462IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.9E-10424459IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
DSPVFNFINN LSPIEAVRSI STAHTFNSLC FTSPPPVFTS PHPTFHRESR FFSWYNRLSF  60
FNQSSCSSCF SIGWFCIVVS VSKEEVEDLN KDASLEEEEE EMSSELPHIL NDSPCMPNLS  120
EPPPGESVSY SEDFKVSLLK LLDAQEENDT PARRRLISDA AELLVFRSPC DSEAFQCLVD  180
TVSSSERRSS QTKQHDVTKD VQANGYCNDN EPLAVGTNQV NTGIHPVPSL HRGSMRRRCL  240
DFEGTGKRKK DDQQTVYDNK AESSSKHVAP GIGLHLNAIA MVSRDSKINV RLTSGAIQKS  300
FSDSNTPVQS QDSLLESLDQ GEHEPGEESA VEELNPGSLR KKQAFLLQEN YCECFAAGVY  360
CIEPCSCVDC FNKPIHEDTV LATRKQIESR NPLAFAPKVI RNSDSITEVG DDASKTPASA  420
RHKRVCNCKK SNCLKKYCEC FQSGVGCSIN CRYEGCKNAF GRKDANKRRI TRNMSEVHQK  480
YKKIKKSSRT QPFLSKNRLP PTQFFLGAGS SSFRKPDSDL TQSRNEKKPL DTVTEEKTEN  540
MPDILSINPI TTIKAIPPNS KRVSPPQPGS SEAGSVLVKR SNGRKLILRS IPAFPSLNPK  600
KSVK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1235249RRRCLDFEGTGKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2051421e-107AF205142.1 Arabidopsis thaliana CXC domain containing TSO1-like protein 1 (SOL1) mRNA, complete cds.
GenBankAY0996531e-107AY099653.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
GenBankAY1288371e-107AY128837.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013587689.10.0PREDICTED: CRC domain-containing protein TSO1
RefseqXP_022557925.10.0CRC domain-containing protein TSO1-like
SwissprotQ9LUI30.0TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLA0A078IU520.0A0A078IU52_BRANA; BnaCnng27630D protein
TrEMBLA0A0D3CH360.0A0A0D3CH36_BRAOL; Uncharacterized protein
TrEMBLA0A3P6EKS80.0A0A3P6EKS8_BRAOL; Uncharacterized protein
STRINGBo5g094500.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]