PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC9006_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family G2-like
Protein Properties Length: 269aa    MW: 30829.5 Da    PI: 10.7685
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC9006_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.72.2e-32204257255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  RrC9006_p1 204 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 257
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.09E-15201257IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28202257IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-23204257IPR006447Myb domain, plants
PfamPF002491.5E-7205256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PSSTWQRRRP EQEDHEELDL GFWRRALDSR TSSLVSNSSS  60
KKNNNHPLED LSLSNNSIHH QQQHPHLLPN YNGSNIFTSS QFPTQQHLQD FLAHDLNTHL  120
RPIRGIPLYQ NPPPHNHYRP PPCFPFDPSS LIHSSSPAPT GINNNTFGTR RVNPNHHNHQ  180
HHHQTLNRAR FMPRFPAKRS MRAPRMRWTT TLHARFVHAV ELLGGHERAT PKSVLELMDV  240
KDLTLAHVKS HLQMYRTVKT TDKAAASSG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0292110.0BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
GenBankAB4934910.0AB493491.1 Arabidopsis thaliana At1g32240 mRNA for hypothetical protein, partial cds, clone: RAAt1g32240.
GenBankAY0486890.0AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013587707.11e-144PREDICTED: probable transcription factor KAN2 isoform X2
RefseqXP_013673787.11e-144PREDICTED: probable transcription factor KAN2, partial
SwissprotQ9C6161e-124KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A0D3CDP11e-144A0A0D3CDP1_BRAOL; Uncharacterized protein
STRINGBra023254.1-P1e-137(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-109G2-like family protein