PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC8798_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 79aa    MW: 9138.83 Da    PI: 9.6566
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC8798_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26065.71.1e-203379147
      DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllk 47
                +CaaCk+lrr+C+kdC+++pyfp ++p kfa++h+++Ga nv+k+l+
  RrC8798_p1 33 RCAACKYLRRRCPKDCIFSPYFPPSDPDKFACIHRIYGAGNVSKMLQ 79
                6********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.70.201.9E-4349No hitNo description
PROSITE profilePS5089116.7943279IPR004883Lateral organ boundaries, LOB
PfamPF031952.6E-193379IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 79 aa     Download sequence    Send to blast
MVSCFNQAIE LSDVKFMQEK KLTEKKSVMN PKRCAACKYL RRRCPKDCIF SPYFPPSDPD  60
KFACIHRIYG AGNVSKMLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-1634781256LOB family transfactor Ramosa2.1
5ly0_B1e-1634781256LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266481e-54AB026648.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MLJ15.
GenBankCP0026861e-54CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankX981301e-54X98130.1 Arabidopsis thaliana 81kb genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018483059.13e-33PREDICTED: LOB domain-containing protein 23
SwissprotP594675e-32LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594685e-32LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A398A7B92e-31A0A398A7B9_BRACM; Uncharacterized protein
STRINGBo7g083780.17e-32(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-34LOB domain-containing protein 24