PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC8434_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 261aa    MW: 29740 Da    PI: 5.4778
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC8434_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.89.9e-40361351100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 aCaaCk++rrkCa+dC lapyfp++++++f n+hklFG+sn++k++k+l++ ++++am +++++++ara+dP++G++++i+klq q+e +k+el+++ +
  RrC8434_p1  36 ACAACKYQRRKCAPDCLLAPYFPHDRHRQFLNAHKLFGVSNITKIIKDLSPPDKDAAMYTIMFQSDARANDPIEGCYSIIRKLQYQIEYSKNELEMVVQ 134
                 7*********************************************************************************************99988 PP

      DUF260 100 e 100
                 +
  RrC8434_p1 135 Q 135
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.90635136IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-3636132IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MPSGKPSSSV FSLHPKPTPL KPSSSTSNNN NTTNQACAAC KYQRRKCAPD CLLAPYFPHD  60
RHRQFLNAHK LFGVSNITKI IKDLSPPDKD AAMYTIMFQS DARANDPIEG CYSIIRKLQY  120
QIEYSKNELE MVVQQLAVFR NHHQEPHIQI QEPEDLSSFS SSCDLNNNSN SIPYSYPLHH  180
VQEPIQQQQE QQQYCSSGNF NGLQEDMWCL QLQDSSTTVN MKGGFIDECE DVKPVEEVSS  240
ETHEFEHHHD GFVEEPYIIS S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-263713612111LOB family transfactor Ramosa2.1
5ly0_B9e-263713612111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018434803.10.0PREDICTED: LOB domain-containing protein 22-like
RefseqXP_018438439.10.0PREDICTED: LOB domain-containing protein 22-like
SwissprotQ9LRW11e-144LBD22_ARATH; LOB domain-containing protein 22
TrEMBLA0A078HKU61e-177A0A078HKU6_BRANA; BnaA01g29810D protein
TrEMBLA0A398AUD41e-177A0A398AUD4_BRACM; Uncharacterized protein
TrEMBLA0A3P5ZSA61e-177A0A3P5ZSA6_BRACM; Uncharacterized protein
STRINGBra021513.1-P1e-177(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64982645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-119LOB domain-containing protein 22
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]