PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC7363_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 139aa    MW: 15882.3 Da    PI: 11.5829
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC7363_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.81.5e-321571158
   CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                +ep++VNaKQyq+Il+RRq+Rakle+++kl +k rkpylheSRh hAl+R+RgsgGrF
  RrC7363_p1 15 NEPVFVNAKQYQAILRRRQRRAKLEAQNKL-IKVRKPYLHESRHLHALKRARGSGGRF 71
                59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.2E-361374IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.6751474IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.2E-271671IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.9E-231739IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068601939IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.9E-234871IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MVPSRMLLPH NIPENEPVFV NAKQYQAILR RRQRRAKLEA QNKLIKVRKP YLHESRHLHA  60
LKRARGSGGR FLNTKKLQES KSPPFLATSV KFRQRDILGV VAVGSSGPDL SGNNDDMFQQ  120
ESQLRFSGYP SNHHVSVLM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-201583267NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12936RRRQRRAK
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018463104.14e-89PREDICTED: nuclear transcription factor Y subunit A-6
RefseqXP_018463105.14e-89PREDICTED: nuclear transcription factor Y subunit A-6
RefseqXP_018464075.15e-91PREDICTED: nuclear transcription factor Y subunit A-6-like
SwissprotQ9LVJ72e-67NFYA6_ARATH; Nuclear transcription factor Y subunit A-6
TrEMBLA0A3P5ZZV63e-86A0A3P5ZZV6_BRACM; Uncharacterized protein
STRINGBra021527.1-P5e-87(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM147331620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.18e-70nuclear factor Y, subunit A6
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]