PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC7194_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TCP
Protein Properties Length: 114aa    MW: 12679.4 Da    PI: 11.1423
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC7194_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP61.14.5e-1973114243
         TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdk 43 
                  g+kdrhsk++T +g+RdRRvRls+++a++++dLq++LG+d+
  RrC7194_p2  73 FGGKDRHSKVCTLRGLRDRRVRLSVPTAIQLYDLQERLGLDQ 114
                 689*************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.3E-1775114IPR005333Transcription factor, TCP
PROSITE profilePS5136922.21675114IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MNTVPWRDAN DDVSGGIRTR RDGEVQKNTE EAVVATSGKP VIKKPPTSIS SSSSSSSWMK  60
SKDPRIVRVS RAFGGKDRHS KVCTLRGLRD RRVRLSVPTA IQLYDLQERL GLDQ
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Binds to the 3'-ACC-5' repeats in the light-responsive promoter (LRP) of psbD, and activates its transcription. Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:11161017, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2324591e-123AC232459.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB020F06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018489088.15e-76PREDICTED: transcription factor TCP13
SwissprotQ9S7W51e-51TCP13_ARATH; Transcription factor TCP13
TrEMBLA0A397ZGA71e-59A0A397ZGA7_BRACM; Uncharacterized protein
STRINGBra039158.1-P1e-58(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91342637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.15e-53plastid transcription factor 1
Publications ? help Back to Top
  1. Skinner MK,Rawls A,Wilson-Rawls J,Roalson EH
    Basic helix-loop-helix transcription factor gene family phylogenetics and nomenclature.
    Differentiation, 2010. 80(1): p. 1-8
    [PMID:20219281]
  2. Yamburenko MV,Zubo YO,Börner T
    Abscisic acid affects transcription of chloroplast genes via protein phosphatase 2C-dependent activation of nuclear genes: repression by guanosine-3'-5'-bisdiphosphate and activation by sigma factor 5.
    Plant J., 2015. 82(6): p. 1030-41
    [PMID:25976841]
  3. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]