PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC7041_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 319aa    MW: 35248.2 Da    PI: 7.2956
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC7041_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.81.6e-4291081100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC+++Cv+apyfp +qp+kfa+vhk+FGasnv kll++l  ++reda++sl+yeAear+rdPvyG+vg+i+ lq++l++l+++l+ +++
  RrC7041_p1   9 PCAACKFLRRKCTQECVFAPYFPPDQPHKFAYVHKIFGASNVAKLLNDLVSNQREDAVNSLFYEAEARLRDPVYGCVGLISILQHRLKKLQHDLDNANK 107
                 7*********************************************************************************************99987 PP

      DUF260 100 e 100
                 e
  RrC7041_p1 108 E 108
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381552.7E-896318IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089126.8428109IPR004883Lateral organ boundaries, LOB
PfamPF031955.2E-429106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MASSSSSSPC AACKFLRRKC TQECVFAPYF PPDQPHKFAY VHKIFGASNV AKLLNDLVSN  60
QREDAVNSLF YEAEARLRDP VYGCVGLISI LQHRLKKLQH DLDNANKELA SYSAPNAMLP  120
MHPQPNFMSL PPQPQRPSSA SSSASVLTQQ QLHNLLPMLT IPTEQLVYHQ QHQDIFETQQ  180
LATVNAVARD QHNEMFRAYG GGSNSPHHHQ NQPQVDILRF NSGFDSVPTG SVTTTGFNQL  240
SSGGSTKTRM SPSLARDGNV VESPPSNDNY HTYEQLHHHQ QHNGAQLFIP TQSSQPLPLQ  300
TQPNSGSQED GRSLIGSSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-4931145116LOB family transfactor Ramosa2.1
5ly0_B4e-4931145116LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018459866.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ31e-137LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A078IG081e-163A0A078IG08_BRANA; BnaC02g44040D protein
TrEMBLA0A0D3AYV31e-163A0A0D3AYV3_BRAOL; Uncharacterized protein
TrEMBLA0A3P6D8V61e-163A0A3P6D8V6_BRAOL; Uncharacterized protein
STRINGBo2g167820.11e-163(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80082441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-113ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]