PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC6_p10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 163aa    MW: 18082.9 Da    PI: 8.805
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC6_p10genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.66.1e-45131121100
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
               +CaaCk+lrrkC+kdCv+apyfpa++p kfa+vhk+FGasnv k+l+ l+e++r+da++s+vyeA+ar++dPvyG+vg+i++lq+qle+l+++la +++e
  RrC6_p10  13 PCAACKLLRRKCVKDCVFAPYFPAKEPYKFAIVHKIFGASNVNKMLQVLSENHRSDAVNSIVYEANARVQDPVYGCVGIISSLQRQLETLQTQLAFAQAE 112
               7**********************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.43612113IPR004883Lateral organ boundaries, LOB
PfamPF031954.5E-4313110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MRRKGHSHGA VSPCAACKLL RRKCVKDCVF APYFPAKEPY KFAIVHKIFG ASNVNKMLQV  60
LSENHRSDAV NSIVYEANAR VQDPVYGCVG IISSLQRQLE TLQTQLAFAQ AELVHMKTLH  120
RIDTKPPPYM ASGISLPANK DLSNDVDMAF LYENGAGESL WSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4491147112LOB family transfactor Ramosa2.1
5ly0_B1e-4491147112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cytokinin. {ECO:0000269|PubMed:17485849}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738421e-113AB473842.1 Arabidopsis thaliana ASL9 mRNA for ASYMMETRIC LEAVES2-like 9 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149087.11e-119PREDICTED: LOB domain-containing protein 3
RefseqXP_013641646.11e-119LOB domain-containing protein 3
SwissprotQ9SA511e-97LBD3_ARATH; LOB domain-containing protein 3
TrEMBLA0A078JJD71e-118A0A078JJD7_BRANA; BnaA06g38340D protein
TrEMBLA0A291LQZ11e-118A0A291LQZ1_BRARR; Transcription factor LBD3
TrEMBLA0A397Z3B71e-118A0A397Z3B7_BRACM; Uncharacterized protein
TrEMBLM4EB831e-118M4EB83_BRARP; Uncharacterized protein
STRINGBra026042.1-P1e-118(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16530.11e-89ASYMMETRIC LEAVES 2-like 9
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]