PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC6925_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 234aa    MW: 25534.8 Da    PI: 4.747
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC6925_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.97.2e-43591581100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r+da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a+la+++ 
  RrC6925_p1  59 PCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHRVFGASNIIKFLQELPESQRTDAVNSMVYEAGARMRDPVYGCAGAIYHLQRQVSELQAQLAKTQV 157
                 7**********************************************************************************************9986 PP

      DUF260 100 e 100
                 e
  RrC6925_p1 158 E 158
                 5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.32358159IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-4259156IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MLKVESIGST STATPTSSAV AVVSASETTT PVSSPSPTSS PPPSLSPQQP PQPPVVLSPC  60
AACKILRRRC AEKCVLAPYF PPTDPAKFTI AHRVFGASNI IKFLQELPES QRTDAVNSMV  120
YEAGARMRDP VYGCAGAIYH LQRQVSELQA QLAKTQVELV SMHLQRSDLL ELLYKMEQTK  180
LSAQEGHQNM SFESSFDSGD ELISSPDEVT NDLGFLEDTN NNNSSMSWWD PLWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-41511603112LOB family transfactor Ramosa2.1
5ly0_B5e-41511603112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738400.0AB473840.1 Arabidopsis thaliana ASL7 mRNA for ASYMMETRIC LEAVES2-like 7 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018434197.11e-174PREDICTED: LOB domain-containing protein 11-like
SwissprotQ9SK081e-124LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A291LQZ01e-132A0A291LQZ0_BRARR; Transcription factor LBD11
TrEMBLA0A397YSL01e-132A0A397YSL0_BRACM; Uncharacterized protein
TrEMBLA0A397ZLR91e-132A0A397ZLR9_BRACM; Uncharacterized protein
TrEMBLM4D6341e-132M4D634_BRARP; Uncharacterized protein
STRINGBra011942.1-P1e-133(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.11e-115LOB domain-containing protein 11