PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC66_p5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 587aa    MW: 62644.2 Da    PI: 8.2804
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC66_p5genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.81.2e-14122161141
       TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
               ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  RrC66_p5 122 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVD 161
               589**************************.********986 PP

2TCR50.73.6e-16207245139
       TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
               k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN 
  RrC66_p5 207 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNF 245
               589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.0E-16122162IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.179123247IPR005172CRC domain
PfamPF036387.3E-11124159IPR005172CRC domain
SMARTSM011144.4E-19207248IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.0E-12210245IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MSEVGGGGGG EFPPKKEDVT DESGFPAKTP ARQLDFTGGN SLSKPTAVVA TTNIVTPSVP  60
SPMASRLHPV GRPVGRPTLQ VVTTNQPSQS QILNAPIRHP KPESPISKPR PPIVEGRDGT  120
PQKKKQCNCK HSRCLKLYCE CFASGTYCDG CNCVNCFNNV DNEPARRDAV EATLERNPNA  180
FRPKIASSPH GVRDKREEIG EVVLLGKHNK GCHCKKSGCL KKYCECFQAN ILCSENCKCL  240
DCKNFDGSEE RQALFHGEHA NNMAYLQQAA NAAITGAVGS SGFAPSPAPK RRKGHDISFN  300
QATKDPSTHR LGQFPQANNG RTIGTSPATV SRPGGNSSAA PSKFVYRSLL ADIIQPQDVK  360
ALCSVLVAVA GEAAKTLTDE RNETEASLAS SAQDNSQGNK DVEMVAADGN RADKSGPEGS  420
NLDGADASKG KPLSPATMAL MCDEQDTIFM VAAAEPNGSV DPGGCRTNSQ EQSEIYAEQE  480
RAVLTKFRDC LSRLISYAEI KESKCSYLAR RHIQSPPTAT ATAAVKTENG IQQIPPVVNG  540
ASRTTAQPTL SKPQPLQPTT TTNTSTTQQH PPHKPPALPE KKDPQNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-3112425611132Protein lin-54 homolog
5fd3_B3e-3112425611132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186580.0AK118658.1 Arabidopsis thaliana At4g29000 mRNA for putative transcription factor, complete cds, clone: RAFL19-93-A20.
GenBankBT0059310.0BT005931.1 Arabidopsis thaliana At4g29000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018470192.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A078HCN60.0A0A078HCN6_BRANA; BnaA01g07920D protein
STRINGBo1g016960.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein