PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC6544_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 331aa    MW: 35782.4 Da    PI: 9.8493
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC6544_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.61.3e-3878136361
      zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                 e alkcprCds ntkfCyynny+l+qPryfCk+CrryWt+GGalrnvPvGgg+r+n k+
  RrC6544_p1  78 EGALKCPRCDSLNTKFCYYNNYNLTQPRYFCKGCRRYWTHGGALRNVPVGGGSRRNSKK 136
                 5689***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2763126IPR003851Zinc finger, Dof-type
PfamPF027017.9E-3380135IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1881135IPR003851Zinc finger, Dof-type
PROSITE patternPS01361083119IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MVFSSNWSQP TNSNHQQHQL HENGSLVSGH GLLSHQLPPY PPNPNPNHHH AAASSGLPAR  60
LGASMAERAR QAKAPPPEGA LKCPRCDSLN TKFCYYNNYN LTQPRYFCKG CRRYWTHGGA  120
LRNVPVGGGS RRNSKKGKNG NSKSSSSLSK QSSSTVNAPS SSSGQLRTNH QFPFSPTLHN  180
LTQLGGIGLN LAATNGNNQA HQIGPSSMND LGFLHVGNER TGNIHDNNNS VQNNLMAAAG  240
SMNQFTLFDP ATTLYAFQNE GNIGISFSST SMVDSRAYHT APVKMEEQPS LVNLSIPVSS  300
LTPSGNQTSQ YFWNNSDLSG PSSNDHHHRL L
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). Involved in the regulation of root development (PubMed:23057675). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Element of a regulatory network controlling indole glucosinolates (IGS) biosynthesis, probably by inducing the expression of accurate genes (e.g. CYP83B1). Promotes apical dominance (PubMed:16740150). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:16740150, ECO:0000269|PubMed:23057675, ECO:0000269|PubMed:30626969}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin and salicylic acid (SA) (PubMed:10758484). Induced transiently in response to the generalist herbivore S.littoralis. Triggered by methyl jasmonate (MeJA) and wounding (PubMed:16740150). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:16740150}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5842851e-158FJ584285.1 Brassica rapa subsp. pekinensis OBF binding protein 2 Dof1.1-2 gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018457779.10.0PREDICTED: dof zinc finger protein DOF1.1-like isoform X1
SwissprotQ8L9V61e-154DOF11_ARATH; Dof zinc finger protein DOF1.1
TrEMBLA0A3P6EPP20.0A0A3P6EPP2_BRAOL; Uncharacterized protein
STRINGBo5g008360.11e-176(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.31e-133Dof family protein
Publications ? help Back to Top
  1. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]