PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC644_p8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 511aa    MW: 56392.1 Da    PI: 8.1029
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC644_p8genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.25.3e-16229267240
        TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                ++k+C+CkkskClk+YCeCfaag++C e C+C dC+Nk 
  RrC644_p8 229 SCKRCHCKKSKCLKLYCECFAAGVYCIEPCTCLDCFNKP 267
                689**********************************96 PP

2TCR52.11.3e-16315353139
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                ++k+gCnC+ks+ClkkYCeC+++g+ Cs +C+Ce+CkN 
  RrC644_p8 315 RHKRGCNCRKSNCLKKYCECYQSGVGCSINCRCEGCKNA 353
                589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.3E-19228269IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.584229355IPR005172CRC domain
PfamPF036381.1E-11231266IPR005172CRC domain
SMARTSM011145.0E-17315356IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.5E-12317353IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MDLVPKGHYS TQSYPPPPLF LIWNMFSFCS HIYSSDPSKE VVLVEETLLE TVQILKNDCF  60
STPTPTPPRA INDGLTDLQR MCDGNVKRKS DTPDWETLFP DTPELLINDT LNDSEVDRCF  120
LPVSSDSKRR SCGGKKPVSN SKESSADGLH RGVRRRLLDF EMPNIKQTSK DSDVGNEYSL  180
SGNIKAGEAA GQSVVEEVPK SSLDLVVMNQ SSPKKKRLKS EQGGEGDSSC KRCHCKKSKC  240
LKLYCECFAA GVYCIEPCTC LDCFNKPIHE ETVLATRKQI ESRNPLAFAP KVIGNADSSI  300
MEVGDDASNT PASARHKRGC NCRKSNCLKK YCECYQSGVG CSINCRCEGC KNAFGRKAAS  360
SFVGLDIKQD DVSETAKTQH RAELFSSVPL PTSTPLSLRQ PLAQLPISFN NMLLPQQSQQ  420
LHGASGSSLY EGQSFRKQGM SLFSHSRIET IAEDIENVIL SPITNINAVS PNSKRVSLPH  480
LDASQMTPRR RNGERKLLLS IPTFPSLTPH R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1523135212120Protein lin-54 homolog
5fd3_B2e-1523135212120Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018489622.10.0PREDICTED: protein tesmin/TSO1-like CXC 3
SwissprotQ8L5481e-170TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLA0A0D3BCT60.0A0A0D3BCT6_BRAOL; Uncharacterized protein
STRINGBo3g081380.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.11e-145Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]