PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC61838_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TCP
Protein Properties Length: 99aa    MW: 10244.7 Da    PI: 11.2916
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC61838_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP125.46e-392292373
          TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73
                 + k++++++hTkv+gR+RR+R++a caar+F+L++eLG+++d++tieWLlqqa+pai++ tgt++++a+++
  RrC61838_p1 22 AVKKPSKDRHTKVDGRGRRIRMPAVCAARVFQLTRELGHKSDGETIEWLLQQAEPAIIATTGTGTIPANFS 92
                 56899***************************************************************887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136927.4892781IPR017887Transcription factor TCP subgroup
PfamPF036341.8E-342799IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 99 aa     Download sequence    Send to blast
PGGGGGGGGS VPSTALAVVK PAVKKPSKDR HTKVDGRGRR IRMPAVCAAR VFQLTRELGH  60
KSDGETIEWL LQQAEPAIIA TTGTGTIPAN FSTLNASLR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00228DAPTransfer from AT1G72010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018457249.12e-62PREDICTED: transcription factor TCP22-like
SwissprotQ9C7G41e-51TCP22_ARATH; Transcription factor TCP22
TrEMBLA0A3P6B6Q28e-57A0A3P6B6Q2_BRACM; Uncharacterized protein
TrEMBLM4DHW38e-57M4DHW3_BRARP; Uncharacterized protein
STRINGBra016090.1-P1e-57(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70532441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72010.12e-35TCP family protein
Publications ? help Back to Top
  1. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  2. Dong H, et al.
    Ubiquitylation activates a peptidase that promotes cleavage and destabilization of its activating E3 ligases and diverse growth regulatory proteins to limit cell proliferation in Arabidopsis.
    Genes Dev., 2017. 31(2): p. 197-208
    [PMID:28167503]