PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC6013_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family BES1
Protein Properties Length: 295aa    MW: 31722.3 Da    PI: 8.4856
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC6013_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8221853.2e-5721301125
      DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl.eeaeaagssas...aspesslq 95 
                 ++++r+ptw+ErEnnkrRERrRRaiaaki++GLR++Gny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg++++ e++e++gs  s   +sp ss+ 
  RrC6013_p2   2 TSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAGWIVEPDGTTYRKGCSRPvERMEIGGSPCSsnfMSPASSSF 100
                 5899**********************************************************************999****999754433588888888 PP

      DUF822  96 sslkssalaspvesysaspksssfpspssl 125
                  +l+s   +s ++  +   ++ss+ ++ss+
  RrC6013_p2 101 ANLTSGDGQSLIPWLKHLSTTSSSSASSSS 130
                 899999999988866554444444333332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.8E-523130IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MTSGTRMPTW RERENNKRRE RRRRAIAAKI FTGLRMYGNY ELPKHCDNNE VLKALCNEAG  60
WIVEPDGTTY RKGCSRPVER MEIGGSPCSS NFMSPASSSF ANLTSGDGQS LIPWLKHLST  120
TSSSSASSSS RLPNNYLYIP GGSISAPVTP PLSSPTTSRG LNQINNSFFV SSTPPSPTRH  180
HQTIIPDSEW FSGIQLAQSV PASPTFSLVS QNPFGFKEAG GGGGSRMWTP GQSGTCSPAI  240
QTGDVPMSET VVASPPEFAF GSNANGLVKA WEGERIHEVS GSDDLELTLG NSSTR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009128310.11e-166PREDICTED: BES1/BZR1 homolog protein 4
SwissprotQ9ZV881e-153BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLM4CVY11e-166M4CVY1_BRARP; Uncharacterized protein
STRINGBra008378.1-P1e-165(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-125BES1/BZR1 homolog 4