PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC59579_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 107aa    MW: 12156.3 Da    PI: 5.3126
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC59579_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP68.99.7e-2262107247
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTS CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCs 47 
                  Cqve+C+ad+s+ak+yh+rhkvCe+h+kap+v + g  qrfCqqCs
  RrC59579_p1  62 CQVERCTADMSRAKQYHKRHKVCEFHAKAPAVRIFGGYQRFCQQCS 107
                  *********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.9E-2155107IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.759107IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.06E-2061107IPR004333Transcription factor, SBP-box
PfamPF031102.5E-1662107IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
MSVRRSNADG KRSLREMSEE EEEDEDTFEE EDNGGEQEQE EALEKKQKGK AASSSTSSGV  60
SCQVERCTAD MSRAKQYHKR HKVCEFHAKA PAVRIFGGYQ RFCQQCS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-1854107256squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013680760.11e-42PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_013744508.11e-42PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_013744507.11e-42PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_013626500.11e-42PREDICTED: squamosa promoter-binding-like protein 3
SwissprotP930159e-37SPL3_ARATH; Squamosa promoter-binding-like protein 3
TrEMBLA0A078CU664e-42A0A078CU66_BRANA; BnaC03g18800D protein
TrEMBLA0A0D3B4R84e-42A0A0D3B4R8_BRAOL; Uncharacterized protein
STRINGBra021880.1-P2e-35(Brassica rapa)
STRINGfgenesh2_kg.4__1394__AT2G33810.11e-35(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.11e-23squamosa promoter binding protein-like 3