PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC5531_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GATA
Protein Properties Length: 184aa    MW: 19771.5 Da    PI: 10.4707
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC5531_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA581.3e-184175135
        GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                C+ Cgt kTplWR gp g+k+LCnaCG++ rkk++
  RrC5531_p1 41 CVDCGTNKTPLWRGGPAGPKSLCNACGIKSRKKRQ 75
                *********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.0313571IPR000679Zinc finger, GATA-type
SMARTSM004019.4E-113586IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.7E-123675No hitNo description
Gene3DG3DSA:3.30.50.101.4E-143975IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.27E-114074No hitNo description
PROSITE patternPS0034404166IPR000679Zinc finger, GATA-type
PfamPF003202.4E-164175IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MSMTEETKTS KFESAAGDSS DVESGGNCSS SGSGGDTKKT CVDCGTNKTP LWRGGPAGPK  60
SLCNACGIKS RKKRQAALGI RQDDNKIKIK NKSNNNLATD HQTVKNGKGE AGNVKKRIKT  120
VDAADDSCSS SRVNKKSLER ASRFLDLGFK VPAMKRSVLE KKRLWRKLGE EERAAVLLMT  180
LSCG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013601550.12e-82PREDICTED: GATA transcription factor 17-like
RefseqXP_013680437.12e-82PREDICTED: GATA transcription factor 17-like
RefseqXP_013699138.12e-82PREDICTED: GATA transcription factor 17-like
SwissprotQ9LIB58e-57GAT17_ARATH; GATA transcription factor 17
TrEMBLA0A0D3A7R42e-82A0A0D3A7R4_BRAOL; Uncharacterized protein
STRINGBra033533.1-P3e-80(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM138161624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16141.12e-68GATA family protein