PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC5394_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 175aa    MW: 19318 Da    PI: 8.1216
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC5394_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.18.8e-4512110199
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+++++
  RrC5394_p1  12 PCAACKFLRRKCMPGCIFAPYFPPEEPHKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISYLQRQVHKLQKELDAANA 110
                 7*********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089128.15511112IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-4412109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MASSSTNTYN SPCAACKFLR RKCMPGCIFA PYFPPEEPHK FANVHKIFGA SNVTKLLNEL  60
LPHQREDAVN SLAYEAEARV RDPVYGCVGA ISYLQRQVHK LQKELDAANA DLVHYGLSTS  120
PPGNLVDLVC QPQPLQLQPL NPVYRLSGAS PVMTQQPRGT GGSYGTFLPW NISEW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-6521161115LOB family transfactor Ramosa2.1
5ly0_B2e-6521161115LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap