PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC5380_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 645aa    MW: 70670.2 Da    PI: 5.8058
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC5380_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.63.8e-16358396240
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  RrC5380_p1 358 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 396
                 689**********************************96 PP

2TCR52.69e-17443481139
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                 ++k+gCnCkks+ClkkYCeCf+ g+ Cs +C+Ce+CkN 
  RrC5380_p1 443 RHKRGCNCKKSNCLKKYCECFQGGVGCSINCRCEGCKNA 481
                 589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.4E-19357398IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.245358483IPR005172CRC domain
PfamPF036386.1E-12360395IPR005172CRC domain
SMARTSM011142.1E-17443484IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.8E-12445481IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 645 aa     Download sequence    Send to blast
DSPVFNYINS LSPIRPVKSI PNPHQFSTLN FTSPPSVFTS PHLTSSHKES RFFKTHHPSS  60
DPTTIPLQES PDDSASNVEA VAEADATTEF NIDASTEMEQ PQIVKETNLD DPLAVSPCGS  120
RETTDLSLVP YASPPREENN GEDAAGMEMQ KMMNDNVQGK NETPDWDRLI ADSSEFLIFS  180
SPNDSEAFRC LMMQRASPSQ APSVMPTMQP GSINEPESSN ASPYGAVSVL HRGIRRRCLD  240
FEMPGNKQTS SENNTVACGS SSRCVVPSIG LHLNALLMST KDCKTNTTTH DYSCSEKYQV  300
GLQGSSSTLQ ETLDQTETAT RDLEVVPDEP TLEELHLSSP KKKRQVLVKM EAGEGESSCK  360
RCNCKKSKCL KLYCECFAAG VYCIEPCSCI DCFNKPIHED TVLATRKQIE SRNPLAFAPK  420
VIKSSDLVLE TGDDASKTPA SARHKRGCNC KKSNCLKKYC ECFQGGVGCS INCRCEGCKN  480
AFGRKDGSSI VDMEAEQEEE NETSKKTKRT KNQENTEVYL MRKEESSALA ATPMSIYRQQ  540
LVQLKNMMPP PQSVLGGGSS SSGMFNSQYT RKPEMKSLET VAEDGAEEMP EILSHTSIDN  600
TKAVSPNGKR VSPPHLDSSS SGRRSGGRKL ILQSIPTFPS LTPQH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1636248014120Protein lin-54 homolog
5fd3_B1e-1636248014120Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018470228.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLA0A3P6EYZ40.0A0A3P6EYZ4_BRAOL; Uncharacterized protein
STRINGBo1g057470.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.10.0TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]