PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC53544_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 88aa    MW: 9419.99 Da    PI: 9.8467
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC53544_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26065.71.1e-204388146
       DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkll 46
                 +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l
  RrC53544_p1 43 PCAACKILRRRCAEKCVLAPYFPPTDPAKFTIAHRVFGASNIIKFL 88
                 7******************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089117.3144288IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-194388IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
TSVAISAVKE TTTPVNSPSP TYSPPSPPLS PQQPQQSPVV LSPCAACKIL RRRCAEKCVL  60
APYFPPTDPA KFTIAHRVFG ASNIIKFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-163788556LOB family transfactor Ramosa2.1
5ly0_B1e-163788556LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013726732.12e-42LOB domain-containing protein 11-like
SwissprotQ9SK082e-33LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A078JDD14e-35A0A078JDD1_BRANA; BnaA04g28360D protein
TrEMBLA0A291LQZ07e-35A0A291LQZ0_BRARR; Transcription factor LBD11
TrEMBLA0A397ZLR97e-35A0A397ZLR9_BRACM; Uncharacterized protein
STRINGBra035698.1-P1e-35(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2065446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-29LOB domain-containing protein 1