PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC518_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YC
Protein Properties Length: 183aa    MW: 20503 Da    PI: 9.0927
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC518_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC44.53.4e-14831651799
      NF-YC  17 knhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                k  ++P+ ri++i+++d+   +i  +a  l+ ka elfi  ++  ++  + + k++ ++   ++++v++ + ++fl d vp++
  RrC518_p2  83 KMIRFPMNRIRRIMRSDNSAPQIMQDAVFLVNKATELFIERFSEEAYESSVQDKKKFIHYKHLSSVVSNDERYEFLADCVPEK 165
                45689***************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.65E-1985164IPR009072Histone-fold
PfamPF008086.3E-2286149IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.7E-2487164IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MVSSKKPNQE KKPSSDGVVV NKAGARNSRS SSGSNSKKKT PKLQAIAKNE PEVHEISESS  60
CSDSDERRKK SNGGGGGVED ANKMIRFPMN RIRRIMRSDN SAPQIMQDAV FLVNKATELF  120
IERFSEEAYE SSVQDKKKFI HYKHLSSVVS NDERYEFLAD CVPEKLKAEV ALEEWERSMT  180
DAG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0252668e-95BT025266.1 Arabidopsis thaliana At1g07980 mRNA, complete cds.
GenBankAY0868158e-95AY086815.1 Arabidopsis thaliana clone 28026 mRNA, complete sequence.
GenBankAK2292668e-95AK229266.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL16-54-O22.
GenBankAK2290118e-95AK229011.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL16-31-C07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013695920.13e-94PREDICTED: chromatin accessibility complex protein 1-like
TrEMBLA0A0A7APS64e-94A0A0A7APS6_BRANA; Transcription factor subunit NF-YC10C
STRINGBra031606.1-P2e-88(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.13e-68nuclear factor Y, subunit C10