PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC4986_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GATA
Protein Properties Length: 311aa    MW: 34472.1 Da    PI: 4.9379
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC4986_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.48.4e-18211245135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  RrC4986_p1 211 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 245
                 99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169926.5E-971300IPR016679Transcription factor, GATA, plant
SMARTSM004018.9E-18205255IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.306205241IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.14E-15208269No hitNo description
Gene3DG3DSA:3.30.50.102.3E-14209243IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.42E-15210257No hitNo description
PROSITE patternPS003440211236IPR000679Zinc finger, GATA-type
PfamPF003201.1E-15211245IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MEKQQQQPTP ELLLVAGNAD SFVVDDLLDF SNDNGQPEDV FESLPDSSAI SAGNLADSSN  60
SSSLYTDGSS FSDDLCVPCE DLAELEWLSN FVEESFSKED QDKLQLLSGG LKKPQTTGLT  120
QTKPEPEPEP ELDQIFILTD TDDSNVYFPA KARSKRSRSA ASTWASRLLA AAGGSDEPFP  180
KKKQHHRVVK EHDIAGETDG DSGEVGGERR CLHCATDKTP QWRTGPMGPK TLCNACGVRY  240
KSGRLVPEYR PASSPTFVTA RHSNSHRKVM ELRRQKEMRD EHLLSQLRSN GEDFLIHCNN  300
NHVAPDFRHL I
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596132.10.0PREDICTED: GATA transcription factor 9-like
SwissprotO826321e-158GATA9_ARATH; GATA transcription factor 9
TrEMBLA0A0D3DHE10.0A0A0D3DHE1_BRAOL; Uncharacterized protein
STRINGBra037037.1-P1e-177(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56822749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.11e-137GATA transcription factor 9