PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC463_p9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 255aa    MW: 27938.9 Da    PI: 6.909
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC463_p9genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA93.13.4e-29170225158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                +ep+YVNaKQyq+Il+RR++Rak+e e+k   ++ kpylheSRhkhA+rR+R+sgGrF
  RrC463_p9 170 QEPVYVNAKQYQGILRRRKARAKAELERKA--TNGKPYLHESRHKHAMRRARASGGRF 225
                69**************************99..899**********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.7E-29168228IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115233.077169228IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.6E-26171225IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006163.8E-22172194IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860174194IPR018362CCAAT-binding factor, conserved site
PRINTSPR006163.8E-22202225IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MESNSGRGNE AEVNHNDAGQ QHQPMMYAEP WWKSNSFGVD RPSLVPSKSS SLEECPDGSE  60
SNDVHSAASE DDGACKDSQA PTSSPSVDNH GTEGNDPAQL AAPVGNMHCQ GQQLVQPPEL  120
VGHYIACVPN PYQDPYYGGM VGSYGHQQLG FHPYPGMPGE RTALPLDVTQ EPVYVNAKQY  180
QGILRRRKAR AKAELERKAT NGKPYLHESR HKHAMRRARA SGGRFAKKTE AEVAAEREKE  240
KGVLQQPTLQ ALNRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-14169225158NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1209218RHKHAMRRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0258011e-101BT025801.1 Arabidopsis thaliana At5g12840 mRNA, complete cds.
GenBankAK3172991e-101AK317299.1 Arabidopsis thaliana AT5G12840 mRNA, complete cds, clone: RAFL21-66-A21.
GenBankY137201e-101Y13720.1 Arabidopsis thaliana mRNA for Hap2a transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399770.11e-123hypothetical protein EUTSA_v10014364mg
SwissprotQ9LXV51e-119NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLV4LN101e-123V4LN10_EUTSA; Uncharacterized protein
STRINGAT5G12840.11e-117(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59462646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.31e-102nuclear factor Y, subunit A1