PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC4447_p6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 220aa    MW: 25117.1 Da    PI: 9.8691
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC4447_p6genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260111.85e-3536127192
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                 aCa+Ck++r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k++++++ee+r+++ +sl++eA +r++dPv G++g +++l+++l+  k+
  RrC4447_p6  36 ACASCKHQRKKCNNECILSPYFPARKNKEFQAVHKVFGVSNVQKMVRTVREEDRTKLSESLTWEALWRQKDPVLGSYGEYRRLSEELKLYKS 127
                 7*************************************************************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.91535135IPR004883Lateral organ boundaries, LOB
PfamPF031958.3E-3336127IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MKERQEVCMT LLKEDDMMQR NSNNSNISSN SPPHQACASC KHQRKKCNNE CILSPYFPAR  60
KNKEFQAVHK VFGVSNVQKM VRTVREEDRT KLSESLTWEA LWRQKDPVLG SYGEYRRLSE  120
ELKLYKSLVH NQPLVTWNSS NNQQCVFNNS NNNKNGLAVN SSGSGGFSVV NNNGVGVNRE  180
IINGGYTSRN LQGGWGNLKQ DQRQQYYAVI NGFKQHHPPH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-173712812104LOB family transfactor Ramosa2.1
5ly0_B1e-173712812104LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018490366.11e-128PREDICTED: LOB domain-containing protein 2-like
SwissprotQ9LNB91e-107LBD2_ARATH; LOB domain-containing protein 2
TrEMBLV4MVQ11e-114V4MVQ1_EUTSA; Uncharacterized protein
STRINGXP_006417938.11e-115(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.15e-89LOB domain-containing protein 2