PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC41_p5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 191aa    MW: 20886.8 Da    PI: 5.6313
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC41_p5genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.83.3e-42361351100
    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
               +CaaCk+lrr+C ++Cvlapyfp ++p+kf ++h++FGasn++kll++lpe++r+da++s+vyeA ar+rdP+yG++g i +lq+q+++l+a+la+++ e
  RrC41_p5  36 PCAACKILRRRCGDKCVLAPYFPPTEPAKFTIAHRVFGASNIIKLLQELPESQRTDAVNSMVYEAGARIRDPIYGCAGAIYNLQRQVSELQAQLAKAQVE 135
               7**********************************************************************************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.97335136IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-4236133IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MLDMEIKCDA SAAIVSASPT SSPPLPQLSP RLVLSPCAAC KILRRRCGDK CVLAPYFPPT  60
EPAKFTIAHR VFGASNIIKL LQELPESQRT DAVNSMVYEA GARIRDPIYG CAGAIYNLQR  120
QVSELQAQLA KAQVEIVSMQ LQRSNLLELI HNMDQPNQGQ HNISSDSSFG NCDEFISSPE  180
SDESGPYQAH L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-423513710112LOB family transfactor Ramosa2.1
5ly0_B8e-423513710112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018480879.11e-126PREDICTED: LOW QUALITY PROTEIN: LOB domain-containing protein 1-like
SwissprotQ9SK087e-89LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A291LQX51e-111A0A291LQX5_BRARR; Transcription factor LBD1a
TrEMBLA0A397Z1P41e-111A0A397Z1P4_BRACM; Uncharacterized protein
STRINGBo5g008590.11e-111(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.16e-88LOB domain-containing protein 11