PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC406_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 132aa    MW: 14737.6 Da    PI: 7.8381
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC406_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601413.9e-4412110199
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                +CaaCk+lrrkC++dCv+apyfp e+p kfanvh++FGasnv+k+l+++ +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+  l+ el+++++
  RrC406_p1  12 PCAACKFLRRKCTSDCVFAPYFPPEEPTKFANVHRIFGASNVSKILQEVAPHQREDAVNSLAYEAEARLRDPVYGCVGAISVLQRQVLGLQRELEETNA 110
                7*********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.22911112IPR004883Lateral organ boundaries, LOB
PfamPF031956.8E-4412109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MSSSYFNYTN SPCAACKFLR RKCTSDCVFA PYFPPEEPTK FANVHRIFGA SNVSKILQEV  60
APHQREDAVN SLAYEAEARL RDPVYGCVGA ISVLQRQVLG LQRELEETNA DIMRYASYLG  120
GETASVYGNR RG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-58101219121LOB family transfactor Ramosa2.1
5ly0_B2e-58101219121LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018485338.12e-94PREDICTED: LOB domain-containing protein 25-like
SwissprotQ8L8Q33e-84LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A078FH292e-84A0A078FH29_BRANA; BnaA06g31930D protein
TrEMBLA0A291LQZ52e-84A0A291LQZ5_BRARR; Transcription factor LBD25a
TrEMBLA0A397Z3H92e-84A0A397Z3H9_BRACM; Uncharacterized protein
TrEMBLM4E9382e-84M4E938_BRARP; Uncharacterized protein
STRINGBra025294.1-P4e-85(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.11e-86LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]