PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC405_p5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 210aa    MW: 24050.2 Da    PI: 10.1641
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC405_p5genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.46.6e-4194169277
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                C v++C+a+l+eak+y+rrh+vCevh+ka++++v+g++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk +
  RrC405_p5  94 CLVDRCTANLTEAKQYYRRHRVCEVHAKASSATVAGVKQRFCQQCSRFHELAEFDETKRSCRRRLAGHNERRRKIS 169
                *************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114130.75291168IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.102.7E-3192155IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.01E-3793172IPR004333Transcription factor, SBP-box
PfamPF031102.6E-3194167IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
LNPKPIHQHC LVLTIASAPS SQHHSLKSLL EMEGQRSRQW GYLKDKAIAT NLAEEEMENG  60
MDGEENDGGD EDKRKRVMER ARGPSTDRVP LRLCLVDRCT ANLTEAKQYY RRHRVCEVHA  120
KASSATVAGV KQRFCQQCSR FHELAEFDET KRSCRRRLAG HNERRRKISG DSFGEGSGRS  180
GISLTQTQER RRIDMKLPMT NSSFKRPQIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-3991167884squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00359DAPTransfer from AT3G15270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0037140.0BT003714.1 Arabidopsis thaliana At3g15270 mRNA, complete cds.
GenBankAK1186110.0AK118611.1 Arabidopsis thaliana At3g15270 mRNA for squamosa promoter binding protein-like 5, putative, complete cds, clone: RAFL19-86-N19.
GenBankAJ2429600.0AJ242960.1 Arabidopsis thaliana mRNA for Squamosa promoter binding protein-like 5, (SPL5 gene).
GenBankAJ0116100.0AJ011610.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638829.11e-121PREDICTED: squamosa promoter-binding-like protein 5
SwissprotQ9S7581e-100SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLA0A078E9121e-121A0A078E912_BRANA; BnaC05g38350D protein
TrEMBLA0A0D3CJZ01e-121A0A0D3CJZ0_BRAOL; Uncharacterized protein
STRINGBra027265.1-P1e-119(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.12e-96squamosa promoter binding protein-like 5