PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC4020_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 226aa    MW: 24905.2 Da    PI: 8.3786
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC4020_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.92.7e-41451441100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lq+q++ l+ael ++++
  RrC4020_p2  45 PCAACKLLRRRCAQECPFSPYFSPHEPHKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQHQVQGLQAELTAVRS 143
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  RrC4020_p2 144 E 144
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.83244145IPR004883Lateral organ boundaries, LOB
PfamPF031957.2E-4245142IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MSRERERFEE IGKKIKREAD TWPHQMAGIR RQMSGPHGTL NTITPCAACK LLRRRCAQEC  60
PFSPYFSPHE PHKFASVHKV FGASNVSKML MEVPESQRAD AANSLVYEAN VRLRDPVYGC  120
MGAISALQHQ VQGLQAELTA VRSEILKYKQ REAVATLMVA SNSQVAGFHN SGGVSVITPQ  180
PQTPSTPPQP TAADHPPPPS SCVFSQPTTR PLEYGDIESE NNSYFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-434514811114LOB family transfactor Ramosa2.1
5ly0_B1e-434514811114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738440.0AB473844.1 Arabidopsis thaliana ASL11 mRNA for ASYMMETRIC LEAVES2-like 11 protein, complete cds.
GenBankBT0252880.0BT025288.1 Arabidopsis thaliana At2g40470 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141907.11e-147PREDICTED: LOB domain-containing protein 15 isoform X2
SwissprotQ8L5T51e-129LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A291LQZ71e-146A0A291LQZ7_BRARR; Transcription factor LBD15
STRINGA0A087H4761e-145(Arabis alpina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-131LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]