PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC387_p6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 148aa    MW: 16914.7 Da    PI: 10.5883
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC387_p6genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA107.41.1e-33965158
  CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
               +ep+YVNaKQyq+Il+RRq+Rak+e e kl +ksrkpylheSRh+hA+rRpRg+gGrF
  RrC387_p6  9 QEPVYVNAKQYQAILRRRQARAKAELEMKL-IKSRKPYLHESRHQHAMRRPRGTGGRF 65
               69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.2E-36768IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.414868IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.9E-291065IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.5E-241133IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068601333IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.5E-244265IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MPLPPEVAQE PVYVNAKQYQ AILRRRQARA KAELEMKLIK SRKPYLHESR HQHAMRRPRG  60
TGGRFAKKTN TEASQPKARE KSNGSRTQSP TSSHSDQPEA WNDEYRTQSE EMQSSASNRR  120
EEAEDCSGQQ WNSISSSNHP SQARLAIK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A9e-21965258NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0939711e-113AY093971.1 Arabidopsis thaliana AT3g20910/MFD22_2 mRNA, complete cds.
GenBankAY0876961e-113AY087696.1 Arabidopsis thaliana clone 37744 mRNA, complete sequence.
GenBankAF4120561e-113AF412056.1 Arabidopsis thaliana AT3g20910/MFD22_2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013749309.15e-89PREDICTED: nuclear transcription factor Y subunit A-9-like isoform X3
RefseqXP_009145532.15e-89PREDICTED: nuclear transcription factor Y subunit A-9 isoform X3
RefseqXP_013749308.15e-89PREDICTED: nuclear transcription factor Y subunit A-9-like isoform X2
RefseqXP_009145531.15e-89PREDICTED: nuclear transcription factor Y subunit A-9 isoform X2
RefseqXP_013749307.15e-89PREDICTED: nuclear transcription factor Y subunit A-9-like isoform X1
RefseqXP_009145530.15e-89PREDICTED: nuclear transcription factor Y subunit A-9 isoform X1
SwissprotQ945M96e-83NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLM4ER197e-89M4ER19_BRARP; Uncharacterized protein
STRINGBra031242.1-P2e-88(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132681829
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.14e-84nuclear factor Y, subunit A9