PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC3862_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 117aa    MW: 13823.3 Da    PI: 10.464
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC3862_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26097.81.1e-30696898
      DUF260  8 lrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98
                 r kC ++Cvl pyfpa++p+k+a++ k+FG ++++++l+++++++r++ ++sl++eAear+rdPvyG vg+i++lq++l++l+  l+ ++
  RrC3862_p3  6 TRAKCRQECVLTPYFPANKPEKYACLMKVFGKKKLVRYLNEIDPSQRQACVDSLIFEAEARIRDPVYGTVGIIHRLQRRLQHLQLSLKIAR 96
                5789*******************************************************************************99888766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089118.957199IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-29695IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MELCATRAKC RQECVLTPYF PANKPEKYAC LMKVFGKKKL VRYLNEIDPS QRQACVDSLI  60
FEAEARIRDP VYGTVGIIHR LQRRLQHLQL SLKIARWELA KLKHEQNHRH LVIRSRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-2779919111LOB family transfactor Ramosa2.1
5ly0_B7e-2779919111LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006448514.11e-30LOB domain-containing protein 6
RefseqXP_006468642.11e-30protein ASYMMETRIC LEAVES 2
RefseqXP_006468643.11e-30protein ASYMMETRIC LEAVES 2
RefseqXP_023904594.14e-30protein LATERAL ORGAN BOUNDARIES-like
RefseqXP_024046965.11e-30LOB domain-containing protein 6
RefseqXP_024046966.11e-30LOB domain-containing protein 6
SwissprotQ9FKZ33e-28LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A397YVE56e-51A0A397YVE5_BRACM; Uncharacterized protein
STRINGBostr.6864s0195.1.p6e-31(Boechera stricta)
STRINGXP_010507369.13e-30(Camelina sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.48e-28LBD family protein
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]