PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC3862_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 201aa    MW: 22608.7 Da    PI: 6.6503
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC3862_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.31e-3741031100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC++ Cv+apyfp ++++++ ++hk+FGas+v k+l++l++++r+da++slvyeA+  + dPv+G+   i +lq+ql+ l+ +++ +++
  RrC3862_p2   4 PCAACKYLRRKCTQACVFAPYFPPNKQEDYTAIHKVFGASQVAKILNDLHPSQRQDAVTSLVYEAQTLLLDPVHGCSLQICNLQRQLKDLQDQVQIARN 102
                 7********************************************************************************************999887 PP

      DUF260 100 e 100
                  
  RrC3862_p2 103 D 103
                 5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.7463104IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-374101IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MTTPCAACKY LRRKCTQACV FAPYFPPNKQ EDYTAIHKVF GASQVAKILN DLHPSQRQDA  60
VTSLVYEAQT LLLDPVHGCS LQICNLQRQL KDLQDQVQIA RNDLAPYNNI VPSLDLQDQV  120
QIARNDLAPY NNIVPPLDLP PPITYQQNIH NPMLMPVVSN YGGQLTSQQL NEEAHRVESE  180
KSAQVKQMQQ NAAQSKRDDC P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-36310710114LOB family transfactor Ramosa2.1
5ly0_B1e-36310710114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018469585.11e-140PREDICTED: LOB domain-containing protein 28
TrEMBLA0A291LR121e-105A0A291LR12_BRARR; Transcription factor LBD28
TrEMBLA0A398AVI71e-105A0A398AVI7_BRACM; Uncharacterized protein
STRINGBo1g084820.11e-105(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50510.12e-52LOB domain-containing protein 28