PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC3653_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GATA
Protein Properties Length: 111aa    MW: 12591.9 Da    PI: 9.9647
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC3653_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.31.1e-182356134
        GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                Cs C+ttkTp+WR gp+g+k+LCnaCG+++ +++
  RrC3653_p2 23 CSDCKTTKTPMWRGGPSGPKSLCNACGIRFMRQR 56
                *****************************97665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577169.03E-141660No hitNo description
PROSITE profilePS5011412.0441750IPR000679Zinc finger, GATA-type
SMARTSM004013.0E-141771IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.4E-152157IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS0034402348IPR000679Zinc finger, GATA-type
CDDcd002022.75E-102352No hitNo description
PfamPF003202.4E-162355IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0048527Biological Processlateral root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
MSMLLFSKFI IEMEEEKERV RCCSDCKTTK TPMWRGGPSG PKSLCNACGI RFMRQRRSEL  60
LGIHSHKAYK KINTSIVSSY GGVFLKKRRS LKEEEQAALC LLLLSCNSVL A
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610592.17e-56PREDICTED: GATA transcription factor 23-like
RefseqXP_013741364.17e-56PREDICTED: GATA transcription factor 23-like
SwissprotQ8LC594e-40GAT23_ARATH; GATA transcription factor 23
TrEMBLA0A078DF988e-56A0A078DF98_BRANA; BnaC09g03390D protein
STRINGBra036600.1-P8e-46(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM144841622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26930.15e-41GATA transcription factor 23