PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC363_p6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GATA
Protein Properties Length: 236aa    MW: 26536.9 Da    PI: 7.7362
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC363_p6genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA581.3e-18164198135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
  RrC363_p6 164 CSHCGVHKTPQWRMGPLGAKTLCNACGVRFKSGRL 198
                *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.3E-832236IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.213158194IPR000679Zinc finger, GATA-type
SMARTSM004013.1E-13158212IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.62E-13158220No hitNo description
Gene3DG3DSA:3.30.50.101.1E-13162196IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS003440164189IPR000679Zinc finger, GATA-type
CDDcd002028.55E-15164220No hitNo description
PfamPF003201.8E-16164198IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MEYVEAFLSD FSVDDLLDFS NTDPFVREKS SPREEEREKA NSSPDQITLH PPLEDILSLP  60
GSDSKLDVPV GDLEDLEWLS NFVDYSFSEP YFSGDFPVNP VASVEVQKQC IPVKPRSKRR  120
RTNGHLWSLG SPYSSLYTGK KKRGRPKAET SSGDGVQQQL RRCCSHCGVH KTPQWRMGPL  180
GAKTLCNACG VRFKSGRLLP EYRPACSPTF STEIHSNSHR KVLELRLMKA VDQGQC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893731e-151AC189373.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB048F07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013665824.11e-149PREDICTED: GATA transcription factor 7 isoform X1
SwissprotO655151e-117GATA7_ARATH; GATA transcription factor 7
TrEMBLA0A078CFG41e-147A0A078CFG4_BRANA; BnaA01g01370D protein
TrEMBLM4D5B61e-147M4D5B6_BRARP; Uncharacterized protein
STRINGBra011673.1-P1e-147(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM146541720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.11e-101GATA transcription factor 7