PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC363_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 117aa    MW: 13337.8 Da    PI: 4.1057
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC363_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260392.3e-1214061100
     DUF260  61 lvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +vyeA ar+rdPvyG++g i +lq+q+++l+a+la+++ e
  RrC363_p1   1 MVYEAGARMRDPVYGCAGAIYHLQRQVSELQAQLAKTQVE 40 
                69*********************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031954.1E-10138IPR004883Lateral organ boundaries, LOB
PROSITE profilePS508919.315141IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MVYEAGARMR DPVYGCAGAI YHLQRQVSEL QAQLAKTQVE LVSMQLQRSD LLELLYKREQ  60
TKLAAQEQGQ QNMSFESSFE SGDEFISSPD EVTNDLGFLE VNNNNNSSVS WWDPLWT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892991e-166AC189299.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB028K05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018478657.12e-81PREDICTED: LOB domain-containing protein 11
SwissprotQ9SK083e-67LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A291LQZ05e-71A0A291LQZ0_BRARR; Transcription factor LBD11
TrEMBLA0A397ZLR95e-71A0A397ZLR9_BRACM; Uncharacterized protein
TrEMBLM4F3P85e-71M4F3P8_BRARP; Uncharacterized protein
STRINGBra035698.1-P8e-72(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.18e-53LOB domain-containing protein 11