PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC3512_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 278aa    MW: 31087.2 Da    PI: 9.0712
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC3512_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.59.1e-1150107562
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                 kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l+  +     l se
  RrC3512_p2  50 KRAKRIIANRQSAARSKERKARYIMELERKVQTLQTEATTLSAQLSLFQRDTTGLSSE 107
                 9*****************************************9999887776666666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.6E-1746110IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.6848111IPR004827Basic-leucine zipper domain
PfamPF001701.3E-950108IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.6E-1150105No hitNo description
SuperFamilySSF579591.05E-1050101No hitNo description
CDDcd147033.48E-2051100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
GGGEEGGSSS RTRHRHSLSV DGGSSSLESI EAKKAMAPDK LAELWVVDPK RAKRIIANRQ  60
SAARSKERKA RYIMELERKV QTLQTEATTL SAQLSLFQRD TTGLSSENTE LKLRLQVMEQ  120
QAKLRDALND QLKKEVERLK FATGEASHTD AYNLGMAHMQ YAQHQPQQQS FFQQQHHHHQ  180
QQTDAQNLQQ MTHQFHLFQP NNNNNNNNQN PNVTSSTTRQ NPQLMHQAGS NPSAQSHSFA  240
EAMHEDPLGR LQGLDISSCG RGSSFGRSDT VSESSSTM
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0742690.0AY074269.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankAY0967460.0AY096746.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankZ860930.0Z86093.1 A.thaliana mRNA for b-Zip DNA binding protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018441811.11e-157PREDICTED: transcription factor RF2b
RefseqXP_018441812.11e-157PREDICTED: transcription factor RF2b
SwissprotO228731e-150BZP18_ARATH; bZIP transcription factor 18
TrEMBLM4CK481e-147M4CK48_BRARP; Uncharacterized protein
STRINGAT2G40620.11e-148(Arabidopsis thaliana)
STRINGBra004582.1-P1e-148(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-126bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]