PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC3421_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 684aa    MW: 75778.4 Da    PI: 8.7684
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC3421_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.2e-094124491954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe+  ++yp+ +++  LAk++gLt +qV++WF N R +
  RrC3421_p2 412 FENflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 449
                 776669******************************88 PP

2BELL90.22e-292843461072
        BELL  10 akLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 +k l l   V++rY+qy++q+q+vi sFe++ag+gsak+YtslAlk+iSr+Fr+Lk+aia+qi
  RrC3421_p2 284 SKKLPLKFSVEQRYRQYHQQMQMVILSFEQAAGIGSAKSYTSLALKTISRQFRSLKEAIAGQI 346
                 566788889*****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.5E-63172344IPR006563POX domain
PfamPF075266.9E-42178343IPR006563POX domain
PROSITE profilePS5007112.293390453IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.0E-28392466IPR009057Homeodomain-like
CDDcd000861.58E-11393453No hitNo description
SMARTSM003892.1E-9393457IPR001356Homeobox domain
SuperFamilySSF466891.41E-16394460IPR009057Homeodomain-like
PfamPF059209.3E-18410449IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 684 aa     Download sequence    Send to blast
MAAYFHGNPP EISAGSDGGL QTLILMNPTT YVQYTQQDND SNNNNNTNNN NNSSFVFLDP  60
HAPPQNTSQQ FVRVPLSGHK AASITSADSI SVLQGYPQRV QYSHYSSHQV DPSHQQAACE  120
SPRAQQGLFL TLSSQQQHQQ QHQNQHQTLH HVGFGSGPGE DIRVGSVGSG VTNGIANLVS  180
SKYLKAAQEL LDEVVKADSN DINTKSQLFS SKKGTSGTDD KAVRESSTGA GEGSGGGGEA  240
SEKLTVEIGT AERQEIQMKK AKLSSMLHEV TTIRYLISHM KWTSKKLPLK FSVEQRYRQY  300
HQQMQMVILS FEQAAGIGSA KSYTSLALKT ISRQFRSLKE AIAGQIKTAN KSLGEKDSVS  360
GVGRLKFVDH HLRQQRAIQQ LGMIQHHPSN NAWRPQRGLP ERAVSVLRSW LFENFLHPYP  420
KDSDKHMLAK QTGLTRSQVS NWFINARVRL WKPMVEEMYM EEMKEQGKNI MEKESNLDNN  480
NEDSASKSTS NQEKSPMKGG GGADNYHPKP NHSGDLEGVT GMQGSPKRLR TNEETMMQPS  540
NVDFTSNEKL AMKILEERQG IRSDGGYPFM GSFGQYQMDE MSRFDVAVSD QELLAQRYSG  600
NNNGMSLTLG LPHCDSLSST HHQGFMQTHH AIPRERRVKI GETEEYGAAT ISAATVHSSA  660
AAYSGMNMQN QKRYVAQLLP DFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-15399457563Homeobox protein Meis2
3k2a_B4e-15399457563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893800.0AC189380.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB050K06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018440077.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_018440078.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A397Z7X40.0A0A397Z7X4_BRACM; Uncharacterized protein
STRINGBo4g036190.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]