PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC3302_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family M-type_MADS
Protein Properties Length: 415aa    MW: 47460.1 Da    PI: 5.9715
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC3302_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF44.22.5e-141152344
                --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
      SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                i+n+s r+ t+ kR++g+lKK  EL +LCd++ + +i+s+ +
  RrC3302_p3 11 ISNDSVRKRTLNKRKKGLLKKLDELKILCDVDMCAVIYSPYN 52
                9**************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.942149IPR002100Transcription factor, MADS-box
SMARTSM004324.6E-17160IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-7323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-20495IPR002100Transcription factor, MADS-box
PfamPF003192.0E-141152IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-72338IPR002100Transcription factor, MADS-box
PRINTSPR004046.6E-73859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MTGKKLNLAY ISNDSVRKRT LNKRKKGLLK KLDELKILCD VDMCAVIYSP YNSTPEVWPS  60
NSEVHKVMEK FEKVPEEERT KRLVNHEEYL IQAITKVKSK IQRLTEDNND KLMKELMFAR  120
LNEDMGDLAI DDSNRGILCE FIDGYLRKVY HHRNVALKDL HLETGESSSM AMAMDMPPIA  180
MAEAGSSSFF NSPQQTNEFQ PLVTLNYGPE HISSHGSQSL NVPTFNFSQQ TNEVQPTISS  240
NQGVEHVHYL GKNFMSAPIF NSPRLTNELQ PLVTSNQGLE HNSSHGSQFL NVPTFKFSQQ  300
TNEVQPTISS NQGLEHVYSL GNNFMNAPIF NPPQQTNEIQ QPIISSNQEA NHVESLASDL  360
FPFSNHGVNT QVMNQDEVHY PLNQQDWHDE EMMKHSQQAC FPWMEENNHY NHHQL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11631RKRTLNKRKKGLLKKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018441124.10.0PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A398AZQ60.0A0A398AZQ6_BRACM; Uncharacterized protein
TrEMBLM4FGM00.0M4FGM0_BRARP; Uncharacterized protein
STRINGBra040248.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28700.18e-54AGAMOUS-like 46